DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and MRGPRX4

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_473373.2 Gene:MRGPRX4 / 117196 HGNCID:17617 Length:322 Species:Homo sapiens


Alignment Length:340 Identity:83/340 - (24%)
Similarity:136/340 - (40%) Gaps:95/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TPYVPYGRRPE------TYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADL 128
            |...|...|.|      |....:|..:|.:||:.|| .:::..|..|..||..:.|||:||.||.
Human    10 TKLTPINGREETPCYNQTLSFTVLTCIISLVGLTGN-AVVLWLLGYRMRRNAVSIYILNLAAADF 73

  Fly   129 LVI---ITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVF-------TLTALSGDRYFAI 183
            |.:   |..:||.              |.::|..::.:.:.|..|       .|:|:|.:|..::
Human    74 LFLSFQIIRLPLR--------------LINISHLIRKILVSVMTFPYFTGLSMLSAISTERCLSV 124

  Fly   184 VDPL--RKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGIN----EKSIVICYP 242
            :.|:  |       .||.|.::....|.:|.|::|..:......:....|.:    |.|..|   
Human   125 LWPIWYR-------CRRPTHLSAVVCVLLWGLSLLFSMLEWRFCDFLFSGADSSWCETSDFI--- 179

  Fly   243 YPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAV 307
             |..|             |::..:.|.|.::  ||:...|..|..:|            ..::.|
Human   180 -PVAW-------------LIFLCVVLCVSSL--VLLVRILCGSRKMP------------LTRLYV 216

  Fly   308 TVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAYC--------MSFANSCANPV 364
            |:|..|::|.:|.||:.:.....|           ..|:...|.||        :|..||.|||:
Human   217 TILLTVLVFLLCGLPFGILGALIY-----------RMHLNLEVLYCHVYLVCMSLSSLNSSANPI 270

  Fly   365 ALYFVSGAFRKHFNR 379
             :||..|:||:..||
Human   271 -IYFFVGSFRQRQNR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 29/111 (26%)
7tm_1 98..364 CDD:278431 66/289 (23%)
MRGPRX4NP_473373.2 7tm_1 44..272 CDD:278431 67/292 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.