DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and MRGPRX2

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001290544.1 Gene:MRGPRX2 / 117194 HGNCID:17983 Length:330 Species:Homo sapiens


Alignment Length:318 Identity:79/318 - (24%)
Similarity:135/318 - (42%) Gaps:77/318 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTV 144
            ||.|...|...|.:||::||| .::..|..|..||..:.|:||||.||.|.:...: :...||  
Human    29 ETLIPVFLILFIALVGLVGNG-FVLWLLGFRMRRNAFSVYVLSLAGADFLFLCFQI-INCLVY-- 89

  Fly   145 EYWPYGSFLCSLS----EFMKDVS-----IGVSVFTLTALSGDRYFAIVDPL--RKFHAHGGGRR 198
                ..:|.||:|    .|...|.     .|:|:  |:.:|.:|..:::.|:  |       .||
Human    90 ----LSNFFCSISINFPSFFTTVMTCAYLAGLSM--LSTVSTERCLSVLWPIWYR-------CRR 141

  Fly   199 ATRMTLATAVSIWLLAIL--------CGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSM 255
            ...::....|.:|.|::|        ||.....|.:                   .|...:  ..
Human   142 PRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDS-------------------GWCQTF--DF 185

  Fly   256 VLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGICF 320
            :...:|::  :.:|:......|:...|..|..:|            ..::.:|:|..|::|.:|.
Human   186 ITAAWLIF--LFMVLCGSSLALLVRILCGSRGLP------------LTRLYLTILLTVLVFLLCG 236

  Fly   321 LPYHV-FFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHF 377
            ||:.: :||..:.|   :|....|.|: ..|:..:|..||.|||: :||..|:|||.:
Human   237 LPFGIQWFLILWIW---KDSDVLFCHI-HPVSVVLSSLNSSANPI-IYFFVGSFRKQW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 32/110 (29%)
7tm_1 98..364 CDD:278431 65/285 (23%)
MRGPRX2NP_001290544.1 7tm_1 47..279 CDD:278431 66/288 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.