DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and MRGPRD

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_944605.2 Gene:MRGPRD / 116512 HGNCID:29626 Length:321 Species:Homo sapiens


Alignment Length:374 Identity:86/374 - (22%)
Similarity:160/374 - (42%) Gaps:100/374 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MNIGLDTSGEAPTALPPMPNVTETLWDLAMVVSQSTQWPLLDTGSSENFSELVTTETPYVPYGRR 78
            ||..|::||...:||                                |:|...|..|.|:     
Human     1 MNQTLNSSGTVESAL--------------------------------NYSRGSTVHTAYL----- 28

  Fly    79 PETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYT 143
                ::..|.....:.|:.|| ::::..|..|..||....|||:||.||||.:.:   :|||: :
Human    29 ----VLSSLAMFTCLCGMAGN-SMVIWLLGFRMHRNPFCIYILNLAAADLLFLFS---MASTL-S 84

  Fly   144 VEYWPYGSFLCSLSEFMKDV-----SIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMT 203
            :|..|..:....:.|.||.:     ::|:|:  |||:|..|..:::.|: .|..|    |...::
Human    85 LETQPLVNTTDKVHELMKRLMYFAYTVGLSL--LTAISTQRCLSVLFPI-WFKCH----RPRHLS 142

  Fly   204 LATAVSIWLLAILC-GLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIP 267
            ......:|.|.:|. ||.:...|  |.|..||..   |:      .::..::.:::..|.    |
Human   143 AWVCGLLWTLCLLMNGLTSSFCS--KFLKFNEDR---CF------RVDMVQAALIMGVLT----P 192

  Fly   268 LVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGICFLPYHVFFLWF-Y 331
            ::.::...:.:.:.           :.:.:..|...::.|.|||.|::|.||.||..::  || .
Human   193 VMTLSSLTLFVWVR-----------RSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIY--WFVL 244

  Fly   332 FWPTAQDDYNAFWHVLRIVAYCM----SFANSCANPVALYFVSGAFRKH 376
            :|.:...:       ::::.:.:    |..:|.|||| :||:.|:.|.|
Human   245 YWLSLPPE-------MQVLCFSLSRLSSSVSSSANPV-IYFLVGSRRSH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 32/104 (31%)
7tm_1 98..364 CDD:278431 65/276 (24%)
MRGPRDNP_944605.2 7tm_1 44..276 CDD:278431 67/279 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.