DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and LOC100333270

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_002666594.1 Gene:LOC100333270 / 100333270 -ID:- Length:393 Species:Danio rerio


Alignment Length:426 Identity:114/426 - (26%)
Similarity:191/426 - (44%) Gaps:73/426 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SSENFSELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILS 122
            :|.||:.:.....|  |:    ...:..:.|||:.:|.|.||..:|.:.::.::||.|.|.::|:
Zfish     6 NSSNFTHINRFVQP--PW----RVALWSVAFALVLLVAVTGNLIVIWIIVAHKRMRTVTNYFLLN 64

  Fly   123 LALADLLVIITTVPLASTVYTVE-YWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDP 186
            ||::|:.|..... |.:.||... :|.:.|..|....|....::..|:::::|::.|||.||:.|
Zfish    65 LAVSDVCVAALNA-LVNFVYGAHGHWYFSSAYCRFQNFYPVAAVFASIYSMSAIALDRYMAIIHP 128

  Fly   187 LRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPAL---IGSNLKHLGINEKSIVICY---PYPE 245
            ::.       |.:.::|.|..|.:|:||.....|..   :...|.|.       .:||   |..:
Zfish   129 MKP-------RLSAKVTKAVIVCVWILAAFLSFPLCFYSVTEVLPHR-------TVCYVAWPRKD 179

  Fly   246 EWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPG-EIQGAVRQVRARRKVAVTV 309
            :....|...:.||    .|.:||.::||.|..:.|.| :....|| ..:..:..::|:|||...:
Zfish   180 DDAFIYHVVVALL----VYLLPLALMAVTYSRVGLTL-WGGDFPGHSSENLLDHLQAKRKVVKMM 239

  Fly   310 LAFVVIFGICFLPYHVFFLWFYF--------WPTAQDDY-NAFWHVLRIVAYCMSFANSCANPVA 365
            :..||.|.||:|||||:|:...|        |  .|..| :..|         :|.::|..||:.
Zfish   240 VIVVVTFAICWLPYHVYFIVTSFNRALRRFKW--IQQVYLSVLW---------LSMSSSMYNPII 293

  Fly   366 LYFVSGAFRKHFNR-YLFC-----------RGASGRRKKRGQHDTFCMHRDTSLTSTASKRFQSR 418
            ...::..||..|.| :.:|           ...:.|.:::.|...|.:.|..|..|.|..|.:| 
Zfish   294 YCCLNSRFRAGFKRVFRWCPFIQMSNCDELELQTARFQQQRQSSVFTVTRMESDGSAAVSRRKS- 357

  Fly   419 HSCYQSTIR-SCRLQETTITTLPNGGNQNGANISAV 453
                .||.| |.|.|.......|:.|..:| |||.|
Zfish   358 ----SSTSRCSVRSQSRPSARPPHNGAPHG-NISCV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 32/100 (32%)
7tm_1 98..364 CDD:278431 76/282 (27%)
LOC100333270XP_002666594.1 7tm_4 30..>167 CDD:304433 41/144 (28%)
7tm_1 40..294 CDD:278431 77/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.