DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and CDYL

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001355054.1 Gene:CDYL / 9425 HGNCID:1811 Length:598 Species:Homo sapiens


Alignment Length:59 Identity:20/59 - (33%)
Similarity:34/59 - (57%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSRE 79
            |.||:|   ::..:|:.:||.:|:||..|..||||.::|..|...|.|:.....::.:|
Human    64 ERIVDK---RKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTEKQKE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 19/49 (39%)
CDYLNP_001355054.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 4/14 (29%)
Interaction with EZH2. /evidence=ECO:0000269|PubMed:22009739 61..309 20/59 (34%)
CD_CDY 62..111 CDD:349284 19/49 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..149 1/8 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..226
crotonase-like 344..540 CDD:119339
Acetyl-CoA-binding domain. /evidence=ECO:0000255 362..594
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.