DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx8b

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001019586.1 Gene:cbx8b / 799361 ZFINID:ZDB-GENE-050522-325 Length:361 Species:Danio rerio


Alignment Length:87 Identity:24/87 - (27%)
Similarity:38/87 - (43%) Gaps:25/87 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIA----DYEAELF-------- 74
            :..|..:.:|..||..:||.||:|:..:..||||.||:......:|    :.|.|:|        
Zfish    11 FAAESIIKRRIRRGHMEYLVKWKGWSPKYSTWEPEENILDPRLFVAFEEREREREIFGPKKRGPK 75

  Fly    75 -------QQSREK------KND 83
                   .|::||      :||
Zfish    76 LKTFLLKAQAKEKAKSYEFRND 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 16/52 (31%)
cbx8bNP_001019586.1 CD_polycomb_like 11..57 CDD:349277 15/45 (33%)
CBX7_C 321..353 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.