DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx8

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001072443.1 Gene:cbx8 / 779897 XenbaseID:XB-GENE-977527 Length:362 Species:Xenopus tropicalis


Alignment Length:60 Identity:21/60 - (35%)
Similarity:34/60 - (56%) Gaps:5/60 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
            :..|..|.:|..:||.:||.||:|:..:..||||.||:... .|:|.:|    .:.||::
 Frog    11 FAAESLLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDA-RLVAAFE----DRERERE 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 18/48 (38%)
cbx8NP_001072443.1 CD_Cbx6 8..65 CDD:349295 21/58 (36%)
CBX7_C <332..354 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.