DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Mphosph8

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001347001.1 Gene:Mphosph8 / 75339 MGIID:1922589 Length:870 Species:Mus musculus


Alignment Length:59 Identity:18/59 - (30%)
Similarity:31/59 - (52%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EKSSE--YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAEL 73
            |:..|  :.||:.|..:...|:..|..:|:||..|..||||..:|..|..::.::..:|
Mouse    52 EEDGEDVFEVERILDMKCEGGKNLYKVRWKGYTSEDDTWEPEVHLEDCKEVLLEFRKKL 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 16/52 (31%)
Mphosph8NP_001347001.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55 1/2 (50%)
CHROMO 58..109 CDD:214605 15/50 (30%)
Histone H3K9me3 binding. /evidence=ECO:0000250|UniProtKB:Q99549 80..87 3/6 (50%)
Neuromodulin_N <97..482 CDD:331332 2/14 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..175
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..234
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..300
ANK 605..729 CDD:238125
ANK 1 610..639
ANK repeat 613..641 CDD:293786
ANK repeat 643..674 CDD:293786
ANK 2 643..672
ANK repeat 676..705 CDD:293786
ANK 3 676..705
ANK 4 709..738
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.