DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx3a

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_005173826.1 Gene:cbx3a / 751689 ZFINID:ZDB-GENE-030131-1158 Length:177 Species:Danio rerio


Alignment Length:61 Identity:23/61 - (37%)
Similarity:36/61 - (59%) Gaps:2/61 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GLGVRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADY 69
            |...:.|:| ..|::|||.:.:|.:.|:.::..||:|:.....||||.||| .|..|||.:
Zfish    10 GKSKKEVQE-IEEFVVEKVMDQRVVNGKVEFFLKWKGFTDADNTWEPEENL-DCPELIAAF 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 20/49 (41%)
cbx3aXP_005173826.1 CD_HP1gamma_Cbx3 21..70 CDD:349299 20/49 (41%)
CD_CSD 110..167 CDD:475127
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.