DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx3b

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001373276.1 Gene:cbx3b / 567497 ZFINID:ZDB-GENE-070628-2 Length:194 Species:Danio rerio


Alignment Length:79 Identity:25/79 - (31%)
Similarity:42/79 - (53%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RNVKEKSS-------EYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYE 70
            :|||.:.:       |:.|||.:.:|...|:.:|..||:|:...:.||||.:|| .|..||.:|.
Zfish     5 QNVKNRKAEETTVVQEFAVEKIIRRRVNNGKVEYYLKWKGFTDAENTWEPEDNL-DCPELIEEYL 68

  Fly    71 AELFQQSREKKNDQ 84
            ..|....:|.:.::
Zfish    69 RNLTVLGQETEQEE 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 20/49 (41%)
cbx3bNP_001373276.1 CD_CSD 20..68 CDD:475127 19/48 (40%)
Chromo_shadow 137..188 CDD:460191
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.