DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Oxp and cbx5

DIOPT Version :9

Sequence 1:	NP_611240.1	Gene:	Oxp / 37002	FlyBaseID:	FBgn0034255	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	NP_001073653.1	Gene:	cbx5 / 563396	ZFINID:	ZDB-GENE-030131-5553	Length:	204	Species:	Danio rerio

Alignment Length:	62	Identity:	25/62 - (40%)
Similarity:	39/62 - (62%)	Gaps:	6/62 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 EYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKKN 82
            ||:|||.|.:|.::||.:|..||:|:..:..||||.:|| .|..||::     |.::.:|.|
Zfish    20 EYVVEKVLDRRVVKGRVEYFLKWKGFTEKHNTWEPEKNL-DCPELISE-----FMKTYKKGN 75

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Oxp	NP_611240.1	CHROMO	21..72	CDD:237991	22/50 (44%)
cbx5	NP_001073653.1	Chromo	21..69	CDD:306815	22/53 (42%)
cbx5	NP_001073653.1	Chromo_shadow	138..190	CDD:307518
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	4	3.920