DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx1

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001017150.1 Gene:cbx1 / 549904 XenbaseID:XB-GENE-1005974 Length:184 Species:Xenopus tropicalis


Alignment Length:74 Identity:30/74 - (40%)
Similarity:44/74 - (59%) Gaps:9/74 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIAD--------YEA 71
            |.|:..||:|||.|.:|.::|:.:||.||:|:..:..||||.||| .|..|||:        ||:
 Frog    14 VDEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDDDNTWEPEENL-DCPDLIAEFLQSQKSAYES 77

  Fly    72 ELFQQSREK 80
            |..:..:.|
 Frog    78 EKTEAGKRK 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 26/58 (45%)
cbx1NP_001017150.1 CD_HP1beta_Cbx1 20..69 CDD:349297 24/49 (49%)
CD_CSD 111..168 CDD:391946
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.