DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and MPHOSPH8

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_047286351.1 Gene:MPHOSPH8 / 54737 HGNCID:29810 Length:879 Species:Homo sapiens


Alignment Length:59 Identity:17/59 - (28%)
Similarity:31/59 - (52%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EKSSE--YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAEL 73
            |:..|  :.|||.|..:...|:..|..:|:||..:..||||..:|..|..::.::..::
Human    52 EEDGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKI 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 16/51 (31%)
MPHOSPH8XP_047286351.1 CD_MMP8 58..108 CDD:349283 15/49 (31%)
PTZ00121 <200..>550 CDD:173412
ANKYR 485..746 CDD:440430
ANK repeat 600..631 CDD:293786
ANK repeat 633..664 CDD:293786
ANK repeat 666..695 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.