powered by:
Protein Alignment Oxp and mphosph8
DIOPT Version :9
Sequence 1: | NP_611240.1 |
Gene: | Oxp / 37002 |
FlyBaseID: | FBgn0034255 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001119905.1 |
Gene: | mphosph8 / 504061 |
ZFINID: | ZDB-GENE-050309-191 |
Length: | 946 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 32/66 - (48%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 KEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREK 80
:::...|.||:.:..|...|...|..:|:.|..|..||||..:|..|..::..|:..|.:...:|
Zfish 15 QDEEDVYEVERIIDVRVEEGEVLYRVRWKNYSSEDDTWEPEAHLDDCKEVLLAYKKALAELKPKK 79
Fly 81 K 81
:
Zfish 80 E 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.