DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and mphosph8

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001119905.1 Gene:mphosph8 / 504061 ZFINID:ZDB-GENE-050309-191 Length:946 Species:Danio rerio


Alignment Length:66 Identity:18/66 - (27%)
Similarity:32/66 - (48%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREK 80
            :::...|.||:.:..|...|...|..:|:.|..|..||||..:|..|..::..|:..|.:...:|
Zfish    15 QDEEDVYEVERIIDVRVEEGEVLYRVRWKNYSSEDDTWEPEAHLDDCKEVLLAYKKALAELKPKK 79

  Fly    81 K 81
            :
Zfish    80 E 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 16/49 (33%)
mphosph8NP_001119905.1 CD_MMP8 20..70 CDD:349283 16/49 (33%)
ANKYR <632..808 CDD:440430
ANK repeat 654..684 CDD:293786
ANK repeat 719..750 CDD:293786
ANK repeat 752..781 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.