powered by:
Protein Alignment Oxp and Cbx4
DIOPT Version :9
Sequence 1: | NP_611240.1 |
Gene: | Oxp / 37002 |
FlyBaseID: | FBgn0034255 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008766707.2 |
Gene: | Cbx4 / 501403 |
RGDID: | 1587243 |
Length: | 551 |
Species: | Rattus norvegicus |
Alignment Length: | 60 |
Identity: | 23/60 - (38%) |
Similarity: | 32/60 - (53%) |
Gaps: | 7/60 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
:.||....||..:||.:||.||.|:..:..||||.||:.....||| .|:||::
Rat 11 FAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIA-------FQNRERQ 63
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Oxp | NP_611240.1 |
CHROMO |
21..72 |
CDD:237991 |
20/49 (41%) |
Cbx4 | XP_008766707.2 |
CD_Cbx4 |
8..62 |
CDD:349292 |
22/57 (39%) |
CBX7_C |
<529..550 |
CDD:407338 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.