powered by:
Protein Alignment Oxp and rhi
DIOPT Version :9
Sequence 1: | NP_611240.1 |
Gene: | Oxp / 37002 |
FlyBaseID: | FBgn0034255 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_536794.1 |
Gene: | rhi / 44879 |
FlyBaseID: | FBgn0004400 |
Length: | 418 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 38/73 - (52%) |
Similarity: | 52/73 - (71%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DLGLGVRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEA 71
:|||......:...||:|||.||||::.||||.|.||.|:|.|..|||||||:|.||.|::|:|:
Fly 9 NLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFES 73
Fly 72 ELFQQSRE 79
|:|:..|:
Fly 74 EVFRLHRK 81
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Oxp | NP_611240.1 |
CHROMO |
21..72 |
CDD:237991 |
32/50 (64%) |
rhi | NP_536794.1 |
CHROMO |
22..72 |
CDD:237991 |
31/49 (63%) |
ChSh |
357..411 |
CDD:294039 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000191 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100000 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.720 |
|
Return to query results.
Submit another query.