DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and rhi

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster


Alignment Length:73 Identity:38/73 - (52%)
Similarity:52/73 - (71%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLGLGVRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEA 71
            :|||......:...||:|||.||||::.||||.|.||.|:|.|..|||||||:|.||.|::|:|:
  Fly     9 NLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFES 73

  Fly    72 ELFQQSRE 79
            |:|:..|:
  Fly    74 EVFRLHRK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 32/50 (64%)
rhiNP_536794.1 CHROMO 22..72 CDD:237991 31/49 (63%)
ChSh 357..411 CDD:294039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100000
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.