DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Oxp and HP1c

DIOPT Version :9

Sequence 1:	NP_611240.1	Gene:	Oxp / 37002	FlyBaseID:	FBgn0034255	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	NP_651093.1	Gene:	HP1c / 42696	FlyBaseID:	FBgn0039019	Length:	237	Species:	Drosophila melanogaster

Alignment Length:	60	Identity:	23/60 - (38%)
Similarity:	32/60 - (53%)	Gaps:	7/60 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    22 YIVEKFLGKRYL-RGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREK 80
            ::||:.:.||.. .|:.:|..||.||.....||||.||. .|..||     :.|::||.|
  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENC-DCPNLI-----QKFEESRAK 61

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Oxp	NP_611240.1	CHROMO	21..72	CDD:237991	19/50 (38%)
HP1c	NP_651093.1	Chromo	9..58	CDD:278797	20/54 (37%)
HP1c	NP_651093.1	Chromo_shadow	89..134	CDD:279701
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1911
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	4	3.820