DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Oxp and cbx1b

DIOPT Version :9

Sequence 1:	NP_611240.1	Gene:	Oxp / 37002	FlyBaseID:	FBgn0034255	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	NP_001002090.1	Gene:	cbx1b / 415180	ZFINID:	ZDB-GENE-040625-68	Length:	203	Species:	Danio rerio

Alignment Length:	55	Identity:	27/55 - (49%)
Similarity:	39/55 - (70%)	Gaps:	1/55 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 VKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADY 69
            |:|:..||:|||.|.:|.::|:.:||.||:|:..|..||||.||| .|..|||::
Zfish    41 VEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPDENL-DCPDLIAEF 94

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Oxp	NP_611240.1	CHROMO	21..72	CDD:237991	25/49 (51%)
cbx1b	NP_001002090.1	Chromo	54..97	CDD:278797	20/42 (48%)
cbx1b	NP_001002090.1	Chromo_shadow	136..187	CDD:279701
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1911
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	4	3.820