DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Pc

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster


Alignment Length:38 Identity:15/38 - (39%)
Similarity:21/38 - (55%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENL 59
            |..||.:.||..:|..:|..||:|:.....||||..|:
  Fly    26 YAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNI 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 15/38 (39%)
PcNP_524199.1 CD_polycomb 23..76 CDD:349291 15/38 (39%)
CBX7_C 341..373 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.