| Sequence 1: | NP_611240.1 | Gene: | Oxp / 37002 | FlyBaseID: | FBgn0034255 | Length: | 84 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_524199.1 | Gene: | Pc / 40358 | FlyBaseID: | FBgn0003042 | Length: | 390 | Species: | Drosophila melanogaster |
| Alignment Length: | 38 | Identity: | 15/38 - (39%) |
|---|---|---|---|
| Similarity: | 21/38 - (55%) | Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENL 59 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Oxp | NP_611240.1 | CD_Rhino | 21..71 | CDD:349280 | 15/38 (39%) |
| Pc | NP_524199.1 | CD_polycomb | 23..76 | CDD:349291 | 15/38 (39%) |
| CBX7_C | 341..373 | CDD:465385 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||