DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx5

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_988907.2 Gene:cbx5 / 394502 XenbaseID:XB-GENE-972727 Length:200 Species:Xenopus tropicalis


Alignment Length:67 Identity:24/67 - (35%)
Similarity:40/67 - (59%) Gaps:8/67 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGVRNVK-------EKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIA 67
            :|.:|.:       .:..||:|||.|.:|.::|:.::|.||:|:..|..||||..|| .|..||:
 Frog    18 MGKKNKRASDASSSSEEEEYVVEKVLDRRVVKGQVEFLLKWKGFSEEHNTWEPDRNL-DCPELIS 81

  Fly    68 DY 69
            ::
 Frog    82 EF 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 22/49 (45%)
cbx5NP_988907.2 CD_HP1alpha_Cbx5 37..85 CDD:349298 21/48 (44%)
CSD_HP1alpha_Cbx5 125..182 CDD:349302
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.