DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Cdyl

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_017456089.1 Gene:Cdyl / 361237 RGDID:1549745 Length:617 Species:Rattus norvegicus


Alignment Length:63 Identity:21/63 - (33%)
Similarity:35/63 - (55%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSRE 79
            |...|.||:|   ::..:|:.:||.:|:||..|..||||.::|..|...|.|:.....::.:|
  Rat    54 ETQVESIVDK---RKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 19/49 (39%)
CdylXP_017456089.1 CD_CDY 56..105 CDD:349284 19/51 (37%)
crotonase-like 363..559 CDD:119339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.