DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Oxp and Cbx1

DIOPT Version :9

Sequence 1:	NP_611240.1	Gene:	Oxp / 37002	FlyBaseID:	FBgn0034255	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	XP_006247295.1	Gene:	Cbx1 / 360609	RGDID:	1310714	Length:	193	Species:	Rattus norvegicus

Alignment Length:	69	Identity:	29/69 - (42%)
Similarity:	45/69 - (65%)	Gaps:	6/69 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 VKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSRE 79
            ::|:..||:|||.|.:|.::|:.:||.||:|:..|..||||.||| .|..|||:     |.||::
  Rat    14 LEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENL-DCPDLIAE-----FLQSQK 72

  Fly    80 KKND 83
            ..::
  Rat    73 TAHE 76

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Oxp	NP_611240.1	CHROMO	21..72	CDD:237991	25/50 (50%)
Cbx1	XP_006247295.1	Chromo	27..70	CDD:278797	21/48 (44%)
Cbx1	XP_006247295.1	Chromo_shadow	126..177	CDD:279701
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1911
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.820