DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Su(var)205

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster


Alignment Length:77 Identity:31/77 - (40%)
Similarity:44/77 - (57%) Gaps:7/77 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQ 76
            |.:.:|:..||.|||.:.:|..:|:.:|..||:|||..:.||||..|| .|..||..|||.  ::
  Fly    14 VSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNL-DCQDLIQQYEAS--RK 75

  Fly    77 SREK----KNDQ 84
            ..||    |.|:
  Fly    76 DEEKSAASKKDR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 24/50 (48%)
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/48 (46%)
ChSh 141..202 CDD:197638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.