DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx2

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_919354.1 Gene:cbx2 / 327291 ZFINID:ZDB-GENE-030131-5502 Length:510 Species:Danio rerio


Alignment Length:61 Identity:22/61 - (36%)
Similarity:32/61 - (52%) Gaps:4/61 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIA----DYEAELFQQSREKK 81
            |..|.||..:|:.:||.||.|:..:..:|||.|||.....|:|    :.|.||....:.|:
Zfish    15 ECILNKRTRKGKLEYLVKWRGWSSKHNSWEPQENLLDPRLLVAFNKREQEKELLISKKGKR 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 19/50 (38%)
cbx2NP_919354.1 Chromo 15..61 CDD:278797 18/45 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.