DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx1a

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_956040.2 Gene:cbx1a / 326746 ZFINID:ZDB-GENE-030131-4945 Length:212 Species:Danio rerio


Alignment Length:69 Identity:31/69 - (44%)
Similarity:44/69 - (63%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSRE 79
            |:|:..||:|||.|.:|.::||.:||.||:|:..|..||||.:|| .|..|||:|      .::.
Zfish    43 VEEEEEEYVVEKVLDRRVVKGRVEYLLKWKGFSEEDNTWEPEDNL-DCPDLIAEY------MTKH 100

  Fly    80 KKND 83
            |.||
Zfish   101 KIND 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 26/50 (52%)
cbx1aNP_956040.2 Chromo 56..96 CDD:278797 20/40 (50%)
Chromo_shadow 145..196 CDD:279701
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.