DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and HP1b

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_572521.2 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster


Alignment Length:62 Identity:28/62 - (45%)
Similarity:39/62 - (62%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
            :|:.||:...||.:.||.:|..||:|||..:.||||:||| .|..|||::|..|....:|.|
  Fly     2 AEFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFEESLKNNKKETK 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 24/49 (49%)
HP1bNP_572521.2 CD_HP1_like 3..52 CDD:349281 24/49 (49%)
CSD 99..150 CDD:349275
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.