DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Cbx8

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_038954.1 Gene:Cbx8 / 30951 MGIID:1353589 Length:362 Species:Mus musculus


Alignment Length:57 Identity:21/57 - (36%)
Similarity:31/57 - (54%) Gaps:4/57 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIA----DYEAELF 74
            :..|..|.:|..:||.:||.||:|:..:..||||.||:.....|.|    :.|.||:
Mouse    11 FAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELY 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 18/52 (35%)
Cbx8NP_038954.1 CD_polycomb_like 11..59 CDD:349277 18/47 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..197
CBX7_C 322..354 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.