DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Cdyl2

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_017456726.1 Gene:Cdyl2 / 292044 RGDID:1309548 Length:551 Species:Rattus norvegicus


Alignment Length:62 Identity:18/62 - (29%)
Similarity:34/62 - (54%) Gaps:3/62 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKKN 82
            |.||:|   ::..:|:.:||.:|:||...:.||||..:|..|...|.::......:.::.|:
  Rat    58 ERIVDK---RKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHLPKDKKVKS 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 17/49 (35%)
Cdyl2XP_017456726.1 CD_CDY 57..105 CDD:349284 17/49 (35%)
crotonase-like 297..493 CDD:119339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.