powered by:
Protein Alignment Oxp and swi6
DIOPT Version :9
| Sequence 1: | NP_611240.1 |
Gene: | Oxp / 37002 |
FlyBaseID: | FBgn0034255 |
Length: | 84 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_593449.1 |
Gene: | swi6 / 2541633 |
PomBaseID: | SPAC664.01c |
Length: | 328 |
Species: | Schizosaccharomyces pombe |
| Alignment Length: | 58 |
Identity: | 24/58 - (41%) |
| Similarity: | 30/58 - (51%) |
Gaps: | 5/58 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 16 KEKSSEYIVEKFLGKRYLR--GRPQYLTKWEGY--PIEQCTWEPLENLGKCMTLIADY 69
:|:..||:|||.|..|..| |..:||.||||| |.:. ||....:...|..||..|
pombe 75 EEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDN-TWSSEADCSGCKQLIEAY 131
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Oxp | NP_611240.1 |
CHROMO |
21..72 |
CDD:237991 |
23/53 (43%) |
| swi6 | NP_593449.1 |
CHROMO |
85..134 |
CDD:237991 |
19/48 (40%) |
| ChSh |
261..326 |
CDD:197638 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.
