DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and chp2

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_596808.1 Gene:chp2 / 2540047 PomBaseID:SPBC16C6.10 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:93 Identity:28/93 - (30%)
Similarity:38/93 - (40%) Gaps:17/93 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQKSIDLGLGVRNV-------KEKSSEYIVEKFLGKRYLRGRP--QYLTKWEGY--PIEQCTWEP 55
            ||..:.|..|...:       |....|:.||..|..|..:...  ||..|||||  |.:. ||..
pombe   149 SQSPVPLNEGFEYIASSGSEDKNSDEEFAVEMILDSRMKKDGSGFQYYLKWEGYDDPSDN-TWND 212

  Fly    56 LENLGKCMTLIADYEAELFQQSREKKND 83
            .|:...|:.||     :.:.:||..|.|
pombe   213 EEDCAGCLELI-----DAYWESRGGKPD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 19/54 (35%)
chp2NP_596808.1 CHROMO 174..228 CDD:237991 19/59 (32%)
ChSh 316..380 CDD:197638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.