DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and CBX5

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_036249.1 Gene:CBX5 / 23468 HGNCID:1555 Length:191 Species:Homo sapiens


Alignment Length:68 Identity:26/68 - (38%)
Similarity:46/68 - (67%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
            |...||:|||.|.:|.::|:.:||.||:|:..|..||||.:|| .|..||::: .:.:::.:|.:
Human    15 EDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNL-DCPELISEF-MKKYKKMKEGE 77

  Fly    82 NDQ 84
            |::
Human    78 NNK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 23/49 (47%)
CBX5NP_036249.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 23/50 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 2/11 (18%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.