DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cec-1

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_498862.1 Gene:cec-1 / 176190 WormBaseID:WBGene00000414 Length:304 Species:Caenorhabditis elegans


Alignment Length:67 Identity:21/67 - (31%)
Similarity:33/67 - (49%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREK-KN 82
            |..|.||..|..|..:|:.::..||.||.....:|||.||:.....:.|.:..|..:::..| |.
 Worm     5 SELYTVESILEHRKKKGKSEFYIKWLGYDHTHNSWEPKENIVDPTLIEAFFTREAARKAEIKAKK 69

  Fly    83 DQ 84
            |:
 Worm    70 DK 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 16/49 (33%)
cec-1NP_498862.1 CD_CSD 8..55 CDD:349274 16/46 (35%)

Return to query results.
Submit another query.