DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and HP1Lcsd

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster


Alignment Length:32 Identity:6/32 - (18%)
Similarity:12/32 - (37%) Gaps:15/32 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YLRGR---------------PQYLTKWEGYPI 48
            ::|||               ..:|.|::..|:
  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPV 37

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 6/32 (19%)
HP1LcsdNP_001246478.1 CSD 10..62 CDD:349275 4/28 (14%)

Return to query results.
Submit another query.