DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and LOC1278505

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_061500649.1 Gene:LOC1278505 / 1278505 VectorBaseID:AGAMI1_000273 Length:177 Species:Anopheles gambiae


Alignment Length:65 Identity:29/65 - (44%)
Similarity:41/65 - (63%) Gaps:6/65 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
            |:.:|:.|||.|..|.:.|:.:|..||:||..|:.||||.||| .|..||     :.|::||:||
Mosquito    13 EEVNEFSVEKILDSRVVNGKVEYFLKWKGYSSEENTWEPEENL-DCDDLI-----QAFKESRKKK 71

  Fly    82  81
            Mosquito    72  71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 23/49 (47%)
LOC1278505XP_061500649.1 None

Return to query results.
Submit another query.