DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Cdyl

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:63 Identity:21/63 - (33%)
Similarity:35/63 - (55%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSRE 79
            |...|.||:|   ::..:|:.:||.:|:||..|..||||.::|..|...|.|:.....::.:|
Mouse    55 ETQVESIVDK---RKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKE 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 19/49 (39%)
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304 20/62 (32%)
CD_CDY 57..106 CDD:349284 19/51 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223
crotonase-like 339..535 CDD:119339
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.