DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and mphosph8

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_002938003.1 Gene:mphosph8 / 100145122 XenbaseID:XB-GENE-968247 Length:847 Species:Xenopus tropicalis


Alignment Length:92 Identity:20/92 - (21%)
Similarity:38/92 - (41%) Gaps:23/92 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYE---------- 70
            :::...:.||..|..:...|...|..:|:||..|..||||..:|..|..::.::.          
 Frog    41 EDEDDVFEVESILDSKIEGGEVLYRVRWKGYDSEGDTWEPEAHLDDCKEVLLEFRRKQAENKPKP 105

  Fly    71 ------------AELFQ-QSREKKNDQ 84
                        ::||: .|..:::||
 Frog   106 VKKEMPQQKLSPSDLFEADSESEQSDQ 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 15/72 (21%)
mphosph8XP_002938003.1 CD_MMP8 46..96 CDD:349283 15/49 (31%)
ANKYR 483..683 CDD:223738
ANK repeat 553..583 CDD:293786
ANK repeat 585..616 CDD:293786
Ank_2 591..680 CDD:372319
ANK repeat 618..649 CDD:293786
PTZ00322 620..>748 CDD:140343
ANK repeat 651..680 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.