DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx3

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_017949990.2 Gene:cbx3 / 100038121 XenbaseID:XB-GENE-492315 Length:227 Species:Xenopus tropicalis


Alignment Length:88 Identity:32/88 - (36%)
Similarity:46/88 - (52%) Gaps:11/88 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQKSIDLGLGVR-NVKEKS------SEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLEN 58
            :.|..|::.:|.: |.|.|.      .|::|||.|.:|.:.|:.:|..||:|:.....||||.||
 Frog    45 LPQLEINMTMGKKQNGKGKKVEEAEPEEFVVEKVLDRRVVNGKVEYYLKWKGFTDSDNTWEPEEN 109

  Fly    59 LGKCMTLIADYEAELFQQSREKK 81
            | .|..||   ||.|..|...|:
 Frog   110 L-DCPELI---EAFLNSQKAGKE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 22/50 (44%)
cbx3XP_017949990.2 CD_HP1gamma_Cbx3 72..121 CDD:349299 23/52 (44%)
CSD_HP1beta_Cbx1 160..217 CDD:349301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.