DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACADVL and Arc42

DIOPT Version :9

Sequence 1:NP_001257376.1 Gene:ACADVL / 37 HGNCID:92 Length:678 Species:Homo sapiens
Sequence 2:NP_650840.1 Gene:Arc42 / 42364 FlyBaseID:FBgn0038742 Length:405 Species:Drosophila melanogaster


Alignment Length:409 Identity:142/409 - (34%)
Similarity:205/409 - (50%) Gaps:33/409 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   117 LNEEQTQFLKELVEPVSRFFEEVNDPAKN---------DALEMVEETTWQGLKELGAFGLQVPSE 172
            ||..|...|..|.|......:...|.|.|         |...:..|...:.:.|||...:.:|.|
  Fly    16 LNARQIASLSALSETHQMLQKSCRDFANNELSGNAAKFDREHLYPEKQIRQMGELGVMAVAIPEE 80

Human   173 LGGVGLCNTQYARLVEIVGMHDLGVGITLGAHQSIGFKGILLFGTKAQKEKYLPKLASGETVAAF 237
            |||.||....||..:|.:.......|:.:..:.|:....:|.||..|||:.|:....:||.|..|
  Fly    81 LGGTGLDYVAYAIAMEEISRGCASAGVIMSVNNSLYLGPLLSFGNDAQKKDYITPFTTGERVGCF 145

Human   238 CLTEPSSGSDAASIRTSAVPSPCGKYYTLNGSKLWISNGGLADIFTVFAKTPVTDPATGAVKEK- 301
            .|:||.:||||.:..|.|...  |.::.|||:|.||:|...|:...|||.|      ...:|.| 
  Fly   146 ALSEPGNGSDAGAASTIATDK--GDHFVLNGTKAWITNAFEAEAAIVFATT------NKQLKHKG 202

Human   302 ITAFVVERGFGGITHGPPEKKMGIKASNTAEVFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFG 366
            |:||:|.:...|.:.|..|.|:||:.|:|.::.|:...||.||:|||.|.|||:||..|:.||.|
  Fly   203 ISAFIVPKATKGFSLGKKEDKLGIRGSSTCQLIFEDCVVPKENMLGEPGFGFKIAMQTLDAGRIG 267

Human   367 MAAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGA 431
            :|....|..:..:..|||:|..|..||:.|.....||:|:|.|.:.......:.:..:...|| .
  Fly   268 IAGQALGIGQAALELAVDYAQKRQAFGKPIAKLQSIQQKIADMSLAMESARLLTWRAAWLKDQ-K 331

Human   432 TDFQIEAAISKIFGSEAAWKVTDECIQIMGGMGFMKEPGVERVLRDLRIFRIFEGTNDILRLFVA 496
            ..:..|||::|:..||||...:.:||||:||||::.:...||..||.||..|:|||::|.||.:|
  Fly   332 QPYTKEAAMAKLAASEAATLCSHQCIQILGGMGYVTDMAAERHYRDARITEIYEGTSEIQRLVIA 396

Human   497 LQGCMDKGKELSGLGSALK 515
                          ||.||
  Fly   397 --------------GSILK 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACADVLNP_001257376.1 VLCAD 95..504 CDD:173850 138/396 (35%)
CaiA 125..496 CDD:224871 134/380 (35%)
Arc42NP_650840.1 CaiA 27..405 CDD:224871 138/398 (35%)
SCAD_SBCAD 29..401 CDD:173847 135/394 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.