DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and UBE3C

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_055486.2 Gene:UBE3C / 9690 HGNCID:16803 Length:1083 Species:Homo sapiens


Alignment Length:520 Identity:143/520 - (27%)
Similarity:234/520 - (45%) Gaps:88/520 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 PSGW--EQRKTASGRVYFVDHNNRTTQFTDPRLSGSILQMIRRGTVPP-TSAANAGTPAPPSATP 625
            |:.|  ||....:.:|         ||...| .|..:.:..|.|.:.| .|..:.|..:||    
Human   624 PNHWLSEQEDIKADKV---------TQLYVP-ASRHVWRFRRMGRIGPLQSTLDVGLESPP---- 674

  Fly   626 ATPSAAAAVPPQATPASNATPTTLTTTTNPPHRIVPDLPQGLLEGADLLPKYRRDLVGK--LRAL 688
                                   |:.:......::.:||       .::|...|..:.:  :.|.
Human   675 -----------------------LSVSEERQLAVLTELP-------FVVPFEERVKIFQRLIYAD 709

  Fly   689 RTELQTMQPQSGHCRLEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKG-----EEGLDYGGVAR 748
            :.|:|...|......:.:.||.|:|::|..:......|::||:.|....     |.|:|.||:.|
Human   710 KQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFR 774

  Fly   749 EWLHLLSREMLNPQYGLFQYSRDDHYTLQINPDSG--VNPDHLSYFHFVGRTLGIAVFHGHCLDG 811
            |:|:.|.:...||..|.|:.:.:.  .|..||.:.  |......:::|:||.||.|::....::.
Human   775 EFLNELLKSGFNPNQGFFKTTNEG--LLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVEL 837

  Fly   812 GFTTPFYKQLLNKPITLGDIE-----GVDPDLHRSLTWM--LESNIS--GIIESTFSVENNSFGA 867
            .|...|..:||.   |..|::     .:||:::::|.::  .|.::.  |:   .|:|.||..|.
Human   838 PFAGFFLSKLLG---TSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGL---NFTVVNNDLGE 896

  Fly   868 LVVHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELE 932
            ..|.|||.||..||||..|:..|:.|..:||..|.|.|..||.::|...::....||.||::|::
Human   897 AQVVELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQ 961

  Fly   933 LVIGG----ISSIDVNDWRNNTRLKHCTNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQ 993
            ::|.|    ||..|:..:.|.:......:...:|  ||:|||.::.|.:.:||:|||..||.||.
Human   962 VLISGAQVPISLEDLKSFTNYSGGYSADHPVIKV--FWRVVEGFTDEEKRKLLKFVTSCSRPPLL 1024

  Fly   994 GFRALQGSTGAVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGF 1058
            ||:.|..:        |.|| ......:.||.|.||.|.:.||.:....||..||..|:|...||
Human  1025 GFKELYPA--------FCIH-NGGSDLERLPTASTCMNLLKLPEFYDETLLRSKLLYAIECAAGF 1080

  Fly  1059  1058
            Human  1081  1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736 8/31 (26%)
HECTc 702..1058 CDD:238033 116/375 (31%)
HECTc 726..1058 CDD:214523 111/351 (32%)
UBE3CNP_055486.2 Cis-determinant of acceptor ubiquitin-binding 1..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
IQ 47..64 CDD:197470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..385
HECTc 725..1081 CDD:238033 118/375 (31%)
HECTc 747..1080 CDD:214523 111/351 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.