DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and HERC3

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens


Alignment Length:409 Identity:125/409 - (30%)
Similarity:207/409 - (50%) Gaps:45/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   680 DLVGKLRALRT--ELQ-----------------TMQP---QSGHCRLEVSRNEIFEESYRLIMKM 722
            |...|.:.|:|  |||                 |::|   :|....|.|.||.:..::.|.:...
Human   658 DAQAKTKMLQTDAELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRNNLVGDALRELSIH 722

  Fly   723 RAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQYSRDDHYTLQINPDSGVNPD 787
            ...|::|.|.|.|.|||.:|.|||.:|:..||.:|:|||.||:|.|.:|.: .|..:....|  :
Human   723 SDIDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELLNPIYGMFTYYQDSN-LLWFSDTCFV--E 784

  Fly   788 HLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPITLGDIEGVDPDLHRSLTWMLESNISG 852
            | ::||.:|.|.|:|:::...:|..|....||:|||....|.|::.:.|...|||..:|:.....
Human   785 H-NWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDYPGED 848

  Fly   853 IIES---TFSVENNSFGALVVHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGF 914
            :.|:   .|::...|:|.:...:|.|||.::.|.::|::|:|..||||.|...:.:.:.|...||
Human   849 VEETFCLNFTICRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGF 913

  Fly   915 CELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRLK---HCTNETTQVLWFWQVVESYSSEM 976
            .::....:|..|...||..::.|.|:.:..:.......|   ..|:.|.::  ||:....:..|.
Human   914 LKVCGGKVLELFQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHPTVKL--FWETFHEFPLEK 976

  Fly   977 RARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETY 1041
            :.:.|.|:|||.|:|:.|..:||          ..|..||. ..:.||.||||:|.:|||.|.:.
Human   977 KKKFLLFLTGSDRIPIYGMASLQ----------IVIQSTAS-GEEYLPVAHTCYNLLDLPKYSSK 1030

  Fly  1042 QLLCDKLTQAVEETCGFAV 1060
            ::|..:||||::...||::
Human  1031 EILSARLTQALDNYEGFSL 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 113/361 (31%)
HECTc 726..1058 CDD:214523 108/337 (32%)
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511
RCC1 2 52..101
RCC1 3 102..154
RCC1 4 156..207
RCC1 5 208..259
RCC1 6 261..311
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033 114/362 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.