DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and UFD4

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_012915.3 Gene:UFD4 / 853859 SGDID:S000001493 Length:1483 Species:Saccharomyces cerevisiae


Alignment Length:407 Identity:105/407 - (25%)
Similarity:184/407 - (45%) Gaps:82/407 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 RLEVSRNEIFEESYRLIMKM-RAKDMRKRLMVKFKGEEG------LDYGGVAREWLHLLSREMLN 760
            :|.:||..||....:::.|. .:.|:   |.::::.|.|      |::..|..::   .:|:.||
Yeast  1102 KLRISRKTIFATGLKILSKYGSSPDV---LEIEYQEEAGTGLGPTLEFYSVVSKY---FARKSLN 1160

  Fly   761 P-QYGLFQY-------SRDDHYTL-----QINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGG 812
            . :...:.|       :.||:.|.     .:||.|. |...:..|.::|..:..::.....||..
Yeast  1161 MWRCNSYSYRSEMDVDTTDDYITTLLFPEPLNPFSN-NEKVIELFGYLGTFVARSLLDNRILDFR 1224

  Fly   813 FTTPFYKQLLNKPIT-------------LGDIEGVDPDLHRSLTWML---ESNISGIIES---TF 858
            |:..|: :||::..|             |..||.|||.|.:||.:::   :.|::  :||   ||
Yeast  1225 FSKVFF-ELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVANKDDNMT--LESLSLTF 1286

  Fly   859 SVENNSFGALVVHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLL 923
            :|..|.     ..||.|||.:..:...|..||:...::....:|||:|..|..:||.::.....:
Yeast  1287 TVPGND-----DIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERM 1346

  Fly   924 RPFDERELELVIGGISSIDVNDWR-----NNTRLKH-CTNETTQVLWFWQVVESYSSEMRARLLQ 982
            ......||..:.|.:.    .||.     .|...:| .|.:::.:..|..::.::....|...||
Yeast  1347 LILFPDELVDIFGRVE----EDWSMATLYTNLNAEHGYTMDSSIIHDFISIISAFGKHERRLFLQ 1407

  Fly   983 FVTGSSRVPLQGFRALQGSTGAVGPRLFTI---H----LTADVPTQNLPKAHTCFNRIDLPPYET 1040
            |:|||.::|:.||::|       .|: ||:   |    ||||   :.||...||.|.:.||.|.:
Yeast  1408 FLTGSPKLPIGGFKSL-------NPK-FTVVLKHAEDGLTAD---EYLPSVMTCANYLKLPKYTS 1461

  Fly  1041 YQLLCDKLTQAVEETCG 1057
            ..::..:|.||:||..|
Yeast  1462 KDIMRSRLCQAIEEGAG 1478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 105/407 (26%)
HECTc 726..1058 CDD:214523 99/383 (26%)
UFD4NP_012915.3 HUL4 581..1482 CDD:227354 105/407 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.