DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and HUL4

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_012570.3 Gene:HUL4 / 853494 SGDID:S000003797 Length:892 Species:Saccharomyces cerevisiae


Alignment Length:380 Identity:113/380 - (29%)
Similarity:188/380 - (49%) Gaps:36/380 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 RLEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQ 767
            :::|.|:.|..:|.|.| |....|:.|.|.::|..|.|:|.||:.:||..||::.:.||..|||.
Yeast   522 KIKVRRDVISHDSLRCI-KEHQGDLLKSLRIEFVNEPGIDAGGLRKEWFFLLTKSLFNPMNGLFI 585

  Fly   768 YSRDDHYT-LQINP-----DSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPI 826
            |.::...: ..|:|     ..|.| ..|..::..|..:|:|:|:...||..|....||:|.::|:
Yeast   586 YIKESSRSWFAIDPPNFDKSKGKN-SQLELYYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPL 649

  Fly   827 TLGDIEGVDPDLHRSLTWML---ESNISGIIESTFSV----------ENNSFGALVVHELKPGGA 878
            :..|...:.|:..|:|..||   |.|...:...||..          ::.|....|..||...|.
Yeast   650 SFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVELCENGR 714

  Fly   879 SIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPS-HLLRPFDERELELVIGG---IS 939
            ::|:|:.||.|:|..:|.:...:.||.|:.....||..:... :.::.|:..|||.::.|   .:
Yeast   715 NVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQT 779

  Fly   940 SIDVNDWRNNTR-LKHCTNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTG 1003
            ..|....|:.|: :...::::..|.|||:::||:...::.:||||||.|.|:|..|...:.    
Yeast   780 KFDFKSLRSVTKYVGGFSDDSRAVCWFWEIIESWDYPLQKKLLQFVTASDRIPATGISTIP---- 840

  Fly  1004 AVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGF 1058
                  |.|.|.....:.:||.||||||.|.|..|.:.:.|..||..|:.|:.|:
Yeast   841 ------FKISLLGSHDSDDLPLAHTCFNEICLWNYSSKKKLELKLLWAINESEGY 889

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 112/378 (30%)
HECTc 726..1058 CDD:214523 105/355 (30%)
HUL4NP_012570.3 HUL4 1..892 CDD:227354 113/380 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.