DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and GAS7

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_958839.1 Gene:GAS7 / 8522 HGNCID:4169 Length:476 Species:Homo sapiens


Alignment Length:217 Identity:55/217 - (25%)
Similarity:82/217 - (37%) Gaps:55/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GQIIISLLSKDG---------------PSSGNPLAIVGPSGDVRGPSEDDSSEDSLPEGWEERRT 178
            |::|..|...||               |:|  .:.::...|.|..|..::|....||.||:...:
Human    26 GELITLLQVPDGGWWEGEKEDGLRGWFPAS--YV
QLLEKPGMVPPPPGEESQTVILPPGWQSYLS 88

  Fly   179 DNGRVYYVNHATKSTQWDRP-RQPGVVGS--SHATSPQQRHNTHNGNSGDRQAPAGPTRSTTCTN 240
            ..||.||||..|..|.|:|| ..||:..|  ||.:|.....|.::.:.    .||.|..:...:.
Human    89 PQGRRYYVNTTTNETTWERPSSSPGIPASPGSHRSSLPPTVNGYHASG----TPAHPPETAHMSV 149

  Fly   241 LMNNGHRSRDLSVTASDERRHSTEILSSVGKENT----------SPTTPVSATTTP--------- 286
            ..:.|. |::|. ::|..::.|        ||||          ..|.|......|         
Human   150 RKSTGD-SQNLG-SSSPSKKQS--------KENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYF 204

  Fly   287 --GKKTSSSNSSSAGGRTLEQR 306
              .||....|.:.||...|.|:
Human   205 WADKKDPQGNGTVAGFELLLQK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028 2/5 (40%)
WW 169..198 CDD:278809 13/28 (46%)
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033
HECTc 726..1058 CDD:214523
GAS7NP_958839.1 SH3_GAS7 5..57 CDD:212763 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..171 20/84 (24%)
WW_FCH_linker 109..201 CDD:374680 22/105 (21%)
F-BAR_GAS7 214..446 CDD:153333 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.