DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and MAGIX

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_079135.3 Gene:MAGIX / 79917 HGNCID:30006 Length:334 Species:Homo sapiens


Alignment Length:298 Identity:67/298 - (22%)
Similarity:94/298 - (31%) Gaps:108/298 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FNIQSLKG-AGFQRLDLG---KLSPDDDELVRGQIIISLLSKDGPSSG-NPLAIVGPSGD----V 156
            |:::.::| ||| .|.||   .::.|....|||      |.||||:.. ..|.:    ||    :
Human   124 FSVELVRGYAGF-GLTLGGGRDVAGDTPLAVRG------LLKDGPAQRCGRLEV----GDLVLHI 177

  Fly   157 RGPSEDDSSEDSLPEGWEERRTDNGRVYYVNHATKSTQWDRPR-----QPGVVGSSHATSPQQRH 216
            .|.|....:.   .:..|..|....:::.|......|...:||     :.|||.|....||.   
Human   178 NGESTQGLTH---AQAVERIRAGGPQLHLVIRRPLETHPGKPRGVGEPRKGVVPSWPDRSPD--- 236

  Fly   217 NTHNGNSGDRQAPAGPTRSTTCTNLMNNGHRSRDLSVTASDERRHSTEILSSVGKENTSPTTPVS 281
                        |.||                   .||.|  |..||.::..          |.|
Human   237 ------------PGGP-------------------EVTGS--RSSSTSLVQH----------PPS 258

  Fly   282 ATTTPGKKTSSSNSSSAGGRTLEQRPTNEPAT--PTSSTTSASVRLHSNDNHVKTPKHQTNGHAP 344
            .||.  |||..|           ..|:.|.|.  ||.|..         :...:.|..|..|...
Human   259 RTTL--KKTRGS-----------PEPSPEAAADGPTVSPP---------ERRAEDPNDQIPGSPG 301

  Fly   345 PESTPTSPTGQQNYVNGNAQNGSTSGNGSGQAAQPQSA 382
            |...|:.          ...:.:....|:.|.||..:|
Human   302 PWLVPSE----------ERLSRALGVRGAAQLAQEMAA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028 12/37 (32%)
WW 169..198 CDD:278809 4/28 (14%)
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033
HECTc 726..1058 CDD:214523
MAGIXNP_079135.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PDZ_signaling 124..206 CDD:238492 25/95 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..306 36/164 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.