DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and Herc3

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001348895.1 Gene:Herc3 / 73998 MGIID:1921248 Length:1050 Species:Mus musculus


Alignment Length:412 Identity:129/412 - (31%)
Similarity:208/412 - (50%) Gaps:51/412 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   680 DLVGKLRALRT--ELQ-----------------TMQP---QSGHCRLEVSRNEIFEESYRLIMKM 722
            |...|.:.|:|  |||                 |::|   :|....|.|.||.:..::.|.:...
Mouse   658 DAQAKTKMLQTDAELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRNHLVGDALRELSIH 722

  Fly   723 RAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQYSRDDHYTLQINPDSGVNPD 787
            ...|::|.|.|.|.||||:|.|||.:|:..||.:|:|||.||:|.|.:|.: .|..:....|  :
Mouse   723 SDIDLKKPLKVIFDGEEGVDAGGVTKEFFLLLLKELLNPIYGMFTYYQDSN-LLWFSDTCFV--E 784

  Fly   788 HLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPITLGDIEGVDPDLHRSLTWMLESNISG 852
            | ::||.:|.|.|:|:::...:|..|....||:|||...:|.|::.:.|...|||..:|:.....
Mouse   785 H-NWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPSLEDLKELSPTEGRSLQELLDYPGED 848

  Fly   853 IIES---TFSVENNSFGALVVHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGF 914
            |.|:   .|:|...|:|.:...:|.|||..:.|.::|::|:|..||||.|...:.:.:.|...||
Mouse   849 IEETFCLNFTVCRESYGVIEQKKLIPGGDRVAVCKDNRQEFVDAYVNYIFQISVHEWYTAFSSGF 913

  Fly   915 CELIPSHLLRPFDERELELVIGGISSIDVND------WRNNTRLKHCTNETTQVLWFWQVVESYS 973
            .::....:|..|...||..::.|.|:.|..:      :|.:....|.|     |..||:....:.
Mouse   914 LKVCGGKVLELFQPAELRAMMVGNSNYDWEELEETAVYRGDYSSTHPT-----VKLFWETFHEFP 973

  Fly   974 SEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPY 1038
            .|.:.:.|.|:|||.|:|:.|..:||          ..|..|| ...:.||.||||:|.:|||.|
Mouse   974 LEKKKKFLLFLTGSDRIPIYGMASLQ----------IIIQSTA-TGEEYLPVAHTCYNLLDLPKY 1027

  Fly  1039 ETYQLLCDKLTQAVEETCGFAV 1060
            .:.:::..:||||::...||::
Mouse  1028 SSKEIMKARLTQALDNYEGFSL 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 117/364 (32%)
HECTc 726..1058 CDD:214523 112/340 (33%)
Herc3NP_001348895.1 ATS1 2..331 CDD:227511
RCC1 313..377 CDD:366085
HECTc 702..1048 CDD:238033 118/365 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.