DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and UBE3A

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_000453.2 Gene:UBE3A / 7337 HGNCID:12496 Length:875 Species:Homo sapiens


Alignment Length:382 Identity:119/382 - (31%)
Similarity:201/382 - (52%) Gaps:38/382 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 QTMQPQSGHCRLEVSRNEIFEES---YRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLL 754
            |.:.|   :.||:|.|:.|.:::   ..:|......|::|:|.|:|:||:|:|.|||::|:..|:
Human   517 QQLNP---YLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLV 578

  Fly   755 SREMLNPQYGLFQYSRDDHYT--LQINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPF 817
            ..|:.||..|:|.|   |..|  ...||.|.   :....|..:|..||:|:::...||..|....
Human   579 VEEIFNPDIGMFTY---DESTKLFWFNPSSF---ETEGQFTLIGIVLGLAIYNNCILDVHFPMVV 637

  Fly   818 YKQLLNKPITLGDIEGVDPDLHRSLTWML--ESNISGIIESTFSV-ENNSFGALVVHELKPGGAS 879
            |::|:.|..|..|:....|.|::||..:|  |.|:...:..||.: :.:.||..::::||..|..
Human   638 YRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDK 702

  Fly   880 IPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPS-----HLLRPFDERELELVIGGIS 939
            ||:|.||::|:|.||.:|...:.:|:||.|.::|| .::.:     :|.||   .|:||:|.|..
Human   703 IPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGF-HMVTNESPLKYLFRP---EEIELLICGSR 763

  Fly   940 SIDVNDWRNNTRLK-HCTNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTG 1003
            ::|.......|... ..|.::..:..||::|.|::.|.:...|||.||:.|.|:.|...|:....
Human   764 NLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIA 828

  Fly  1004 AVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGFAV 1060
            ..||           .|:.||.:|||||.:.||.|.:.:.|.::|.:|:....||.:
Human   829 KNGP-----------DTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGM 874

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 115/369 (31%)
HECTc 726..1058 CDD:214523 109/342 (32%)
UBE3ANP_000453.2 AZUL 29..83 CDD:406862
HECTc 523..873 CDD:238033 116/370 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.