DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and Herc6

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_080268.1 Gene:Herc6 / 67138 MGIID:1914388 Length:1003 Species:Mus musculus


Alignment Length:372 Identity:104/372 - (27%)
Similarity:180/372 - (48%) Gaps:49/372 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 LEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQY 768
            |:|.|:.:.|::.|.:.::...|:||:|.|.|..|...:.|||:.|:.|.:..||.:|:|.:|.|
Mouse   660 LKVRRSHLVEDTLRQLRQVEDFDLRKQLSVGFINEIRPEAGGVSSEFFHCIFEEMTDPKYEMFIY 724

  Fly   769 SRDDHYTLQINPDSG------VNP--DHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKP 825
                       |:.|      |||  :..|||.| |...|:::.:...::..|....||:|||:.
Mouse   725 -----------PEKGSSMWFPVNPKFEKSSYFLF-GILCGLSLHNLKVINLPFPLALYKKLLNQK 777

  Fly   826 ITLGDIEGVDPDLHRSLTWMLESNISGIIEST---FSVENNSFGALVVHELKPGGASIPVTEENK 887
            .:|.|::.:...|.|:|..:|... :|.||..   ||:..:....    :|.|.|.|:||.|.||
Mouse   778 PSLEDLKELSLPLGRNLQEVLNCE-AGDIEELHMYFSIYWDQKDV----DLIPDGISVPVNETNK 837

  Fly   888 REYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRL 952
            |:||..||:|.|...|:..:....:||.::....::|.|...||...|.|.::.|...:.||::.
Mouse   838 RDYVSKYVDYIFNISIKTIYEEFHRGFYKVCNWDIIRQFQPEELMTAIIGNATCDWKQFENNSKY 902

  Fly   953 K------HCTNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFT 1011
            |      |.|     :|.||:.....:.:.:.:.|.|:||..|:.::|.:    :.|.|      
Mouse   903 KDGYDKSHPT-----ILLFWKAFHDLTLDEKKKFLLFLTGCDRLHVKGLQ----NEGIV------ 952

  Fly  1012 IHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGF 1058
            ...:.....::.|::.||...:|||.|.:.:.:.:.|..|:..:.||
Mouse   953 FRCSETFSEEDNPRSLTCHRMLDLPKYSSMRRMKEALQVAINNSTGF 999

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 102/370 (28%)
HECTc 726..1058 CDD:214523 97/348 (28%)
Herc6NP_080268.1 RCC1 1 40..91
RCC1 40..89 CDD:278826
RCC1 2 92..144
RCC1 92..142 CDD:278826
RCC1 145..195 CDD:278826
RCC1 3 146..197
RCC1_2 183..211 CDD:290274
RCC1 4 199..252
RCC1_2 237..266 CDD:290274
RCC1 5 253..303
RCC1 253..300 CDD:278826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281
chaperonin_like <570..>652 CDD:295468
HECTc 658..999 CDD:238033 102/370 (28%)
HECTc 682..999 CDD:214523 97/348 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.