DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and wwtr1

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001032785.1 Gene:wwtr1 / 568008 ZFINID:ZDB-GENE-051101-1 Length:391 Species:Danio rerio


Alignment Length:287 Identity:64/287 - (22%)
Similarity:96/287 - (33%) Gaps:86/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SSGNPLAIVGPSGDVRGPSE------------DDSSEDSLPEGWEERRTDNGRVYYVNHATKSTQ 194
            |..:|.::..|:|.|.|||.            |.:.|..||.|||...|.||:.|::||..|.|.
Zfish    77 SRSSPASLQLPAGSVSGPSPGRLHSHTRHQSCDVAEELPLPPGWEMAFTPNGQKYFLNHIEKITT 141

  Fly   195 WDRPR------------------------------QPGVVGSSHATSPQQRHNTHNGNSGDRQAP 229
            |..||                              ||.:|.:..|...||:|..........|.|
Zfish   142 WHDPRKSMTPSVAQLSLHNQVSNTASIQQRSMALSQPNLVLNQQAHQQQQQHLQQQQQQVPVQVP 206

  Fly   230 AGPTRSTTCTNLMN-----NGHRSRDLSVTASDER--RHSTEILSS--------VGKENTSPTTP 279
            ....:..:...:||     :..:.|...:....||  |...|::..        :..:|..|..|
Zfish   207 VQAPQQQSSQPMMNLSAQQHQQKMRLQRIQMERERIQRRQEELMRQEVALRQLPMDSDNLPPVAP 271

  Fly   280 VSATTTPGKKTSSSNSSSAGGRTLEQRPTNEPATPTSSTTSASVRLHSNDNHVKTPKHQTNGHAP 344
                      ...|.:.|||     ..|.|          ||...|:|...|.:.....:.....
Zfish   272 ----------AIGSPAMSAG-----NMPNN----------SADPFLNSGPYHSREQSTDSGLGLG 311

  Fly   345 PESTPTSPTGQQNYVNGNAQNGSTSGN 371
            ..|.||:|   ::::| |.::..|..|
Zfish   312 CYSIPTTP---EDFLN-NMEDMDTGEN 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809 14/28 (50%)
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033
HECTc 726..1058 CDD:214523
wwtr1NP_001032785.1 WW 115..146 CDD:197736 14/30 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.