DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and wwc3

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001103940.1 Gene:wwc3 / 566492 ZFINID:ZDB-GENE-070209-229 Length:1148 Species:Danio rerio


Alignment Length:311 Identity:74/311 - (23%)
Similarity:115/311 - (36%) Gaps:62/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 LDLPPGYEMRTTQQGQVYFYHIPTGVSTWHDPRIPRDFDTQHLTL-DAIG-PLPSGWEQRKTASG 575
            |.||||:|......|:|::....|..::|.|   |||..|:.||. |.:| .||.|||.......
Zfish    15 LPLPPGWEEARDYDGRVFYIDHNTRQTSWID---PRDRITKPLTFADCVGDELPLGWEVVYDQQV 76

  Fly   576 RVYFVDHNNRTTQFTDPRLSGSILQ--MIRRGTVPPTSAANAGTPAPPSATPATPSAAAAVPPQA 638
            .||::||.|:|||..:||......|  |::...|....|.||            ......:..|.
Zfish    77 GVYYIDHINKTTQIENPRTQWRQEQERMLKEYLVVAQEALNA------------KKEMYQIKQQR 129

  Fly   639 TPASNATPTTLTTTTNPPHRIVPDLPQGLLEGADLLPKY-------RRDLVGKLR----ALRTEL 692
            ...:..........|...:|.:.....|....|...|..       ||:.:.:|:    .:|.||
Zfish   130 LELAQQEMQLFNQLTQDDNRSITSSHSGSSSNAKYDPDQIKAEIACRRERLSRLKQELAQMRQEL 194

  Fly   693 Q-------TMQPQSGHCRLEVSR-------NEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDY 743
            |       |:|        |:.|       |...:|:..:..::|:  ::|.:....|..:.| .
Zfish   195 QYKEMGVETLQ--------EIDRKMSSSQTNYKLDEAQAIFSELRS--IKKAISTGEKERQDL-I 248

  Fly   744 GGVAREWLHLLS--REMLNPQYGLFQYSRDDHYTLQINPDSGVNPDHLSYF 792
            ..:|:..|:...  .|:.|....|........||     |:|...|.:..|
Zfish   249 QSLAKLTLNFCDSINEVTNNAESLADSCSVQQYT-----DAGCQTDLMGEF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736 10/31 (32%)
WW 562..594 CDD:197736 14/31 (45%)
HECTc 702..1058 CDD:238033 19/100 (19%)
HECTc 726..1058 CDD:214523 14/69 (20%)
wwc3NP_001103940.1 WW 17..46 CDD:278809 10/31 (32%)
WW 64..93 CDD:278809 13/28 (46%)
C2_Kibra 677..800 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.