DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and herc4

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_005173092.1 Gene:herc4 / 557513 ZFINID:ZDB-GENE-070801-1 Length:1052 Species:Danio rerio


Alignment Length:367 Identity:114/367 - (31%)
Similarity:186/367 - (50%) Gaps:35/367 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 LEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQY 768
            |.|.|..:..:|..::.|.:..|.:|.|.|.|.|||.:|.|||.:|:..|:.:|:|:|:||:|::
Zfish   706 LIVRRENVVGDSMEVLRKSKNVDYKKPLKVIFVGEEAVDAGGVRKEFFLLIMKELLHPKYGMFRF 770

  Fly   769 SRDDH---YTLQINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPITLGD 830
            ..:..   :..:...|       :..||.:|...|:|:::...::..|....||:||.|..||.|
Zfish   771 HEESRLIWFACKTFED-------IDLFHLIGVVCGLAIYNLTIVELNFPLALYKKLLKKTPTLED 828

  Fly   831 IEGVDPDLHRSLTWMLESNISGIIES---TFSVENNSFGALVVHELKPGGASIPVTEENKREYVK 892
            ::.:.||:.|||..:|:.....:.|:   .|::..::|||..|.||.|.|..|.|.:.|::|:|.
Zfish   829 LKELMPDVGRSLQQLLDYTEDDLEETFCLNFTITEDNFGATEVVELIPNGTDISVNKSNRQEFVN 893

  Fly   893 LYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRLK---- 953
            .||:|.|.:.:..||.|...||.::....:|..|...||:.::.|.::.|..:...:|..|    
Zfish   894 AYVDYIFNKSVAPQFSAFYAGFHKVCGGKVLELFQPSELQAMVIGNTNYDWKELEKSTEYKGEYW 958

  Fly   954 --HCTNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLTA 1016
              |.|     :..||:|......|.:.:.|.|:|||.|:|:.|.::|          ...|..||
Zfish   959 ADHPT-----IKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSL----------ALVIQPTA 1008

  Fly  1017 DVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGF 1058
            . ..|..|.||||||.:|||.|.:...:.:||..|:|...||
Zfish  1009 G-GEQYFPVAHTCFNLLDLPKYTSKNTMQEKLLHAIEHNQGF 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 112/365 (31%)
HECTc 726..1058 CDD:214523 107/343 (31%)
herc4XP_005173092.1 RCC1 3..49 CDD:278826
RCC1 52..99 CDD:278826
RCC1 102..152 CDD:278826
RCC1 156..205 CDD:278826
RCC1 208..257 CDD:278826
RCC1 260..308 CDD:278826
RCC1 313..377 CDD:278826
HECTc 704..1049 CDD:238033 112/365 (31%)
HECTc 730..1049 CDD:214523 106/341 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.